SCOP 1.73: Domain d2gm3e1: 2gm3 E:5-175

Lineage for d2gm3e1 (2gm3 E:5-175)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (6 proteins)
   Pfam PF00582

6. Protein Putative ethylene-responsive protein AT3g01520/F4P13_7 [142091] (1 species)

7. Species Arabidopsis thaliana [TaxId:3702] [142092] (1 PDB entry)

8. Domain d2gm3e1: 2gm3 E:5-175 [135358]
   automatically matched to 2GM3 A:5-175
   complexed with amp

Details for d2gm3e1

PDB Entry: 2gm3, 2.46 Å

PDB Description: crystal structure of an universal stress protein family protein from arabidopsis thaliana at3g01520 with amp bound

PDB Compounds: (E:) unknown protein

SCOP Domain Sequences for d2gm3e1:

Sequence, based on SEQRES records:

>d2gm3e1 c.26.2.4 (E:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Arabidopsis thaliana [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedgfddv
dsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvr
pdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd

Sequence, based on observed residues (ATOM records):

>d2gm3e1 c.26.2.4 (E:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Arabidopsis thaliana [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
rdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrg
lgtvsafcvkhaecpvmtikrnadetpsdpadd

Timeline for d2gm3e1:

• d2gm3e1 is new in SCOP 1.73
  
• d2gm3e1 appears in SCOP 1.75
  
• d2gm3e1 appears in the current release, SCOPe 2.08, called d2gm3e_