Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.4: Universal stress protein-like [52436] (6 proteins) Pfam PF00582 |
Protein Putative ethylene-responsive protein AT3g01520/F4P13_7 [142091] (1 species) |
Species Arabidopsis thaliana [TaxId:3702] [142092] (1 PDB entry) |
Domain d2gm3d1: 2gm3 D:5-175 [135357] automatically matched to 2GM3 A:5-175 complexed with amp |
PDB Entry: 2gm3 (more details), 2.46 Å
SCOP Domain Sequences for d2gm3d1:
Sequence, based on SEQRES records: (download)
>d2gm3d1 c.26.2.4 (D:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Arabidopsis thaliana [TaxId: 3702]} ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedgfddv dsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvr pdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
>d2gm3d1 c.26.2.4 (D:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Arabidopsis thaliana [TaxId: 3702]} ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf rdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrg lgtvsafcvkhaecpvmtikrnadetpsdpadd
Timeline for d2gm3d1: