Lineage for d2gm3b1 (2gm3 B:5-174)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693721Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 693878Family c.26.2.4: Universal stress protein-like [52436] (6 proteins)
    Pfam PF00582
  6. 693898Protein Putative ethylene-responsive protein AT3g01520/F4P13_7 [142091] (1 species)
  7. 693899Species Arabidopsis thaliana [TaxId:3702] [142092] (1 PDB entry)
  8. 693901Domain d2gm3b1: 2gm3 B:5-174 [135355]
    automatically matched to 2GM3 A:5-175
    complexed with amp

Details for d2gm3b1

PDB Entry: 2gm3 (more details), 2.46 Å

PDB Description: crystal structure of an universal stress protein family protein from arabidopsis thaliana at3g01520 with amp bound
PDB Compounds: (B:) unknown protein

SCOP Domain Sequences for d2gm3b1:

Sequence, based on SEQRES records: (download)

>d2gm3b1 c.26.2.4 (B:5-174) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Arabidopsis thaliana [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedgfddv
dsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvr
pdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpad

Sequence, based on observed residues (ATOM records): (download)

>d2gm3b1 c.26.2.4 (B:5-174) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Arabidopsis thaliana [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
rdmglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrglgtvsaf
cvkhaecpvmtikrnadetpsdpad

SCOP Domain Coordinates for d2gm3b1:

Click to download the PDB-style file with coordinates for d2gm3b1.
(The format of our PDB-style files is described here.)

Timeline for d2gm3b1: