![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.3: FwdE-like [143555] (1 family) ![]() contains extra N-terminal and C-terminal structures |
![]() | Family d.81.3.1: FwdE-like [143556] (1 protein) Pfam PF02663; Tungsten formylmethanofuran dehydrogenase, subunit E, FwdE, is a stand-alone domain of this fold |
![]() | Protein FwdE-like protein DSY1837 (Dhaf_2201) [143557] (1 species) |
![]() | Species Desulfitobacterium hafniense [TaxId:49338] [143558] (1 PDB entry) |
![]() | Domain d2glzb1: 2glz B:4-151 [135349] automatically matched to 2GLZ A:3-151 complexed with edo, zn |
PDB Entry: 2glz (more details), 1.45 Å
SCOP Domain Sequences for d2glzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glzb1 d.81.3.1 (B:4-151) FwdE-like protein DSY1837 (Dhaf_2201) {Desulfitobacterium hafniense [TaxId: 49338]} ektpwelvidfhghtcpdialgyriaqlaqremgirpapdseclvkaytqscaldaiqvl nkatigrhaliieethrymyqfhftgtqdihqftvspavldhletlrhpdlsprerqnkv legvqyvltleesafchydkipgqlski
Timeline for d2glzb1: