Lineage for d2glzb_ (2glz B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527754Superfamily d.81.3: FwdE-like [143555] (1 family) (S)
    contains extra N-terminal and C-terminal structures
    automatically mapped to Pfam PF02663
  5. 2527755Family d.81.3.1: FwdE-like [143556] (2 proteins)
    Pfam PF02663; Tungsten formylmethanofuran dehydrogenase, subunit E, FwdE, is a stand-alone domain of this fold
  6. 2527756Protein FwdE-like protein DSY1837 (Dhaf_2201) [143557] (1 species)
  7. 2527757Species Desulfitobacterium hafniense [TaxId:49338] [143558] (1 PDB entry)
    Uniprot Q24WG6 3-151
  8. 2527759Domain d2glzb_: 2glz B: [135349]
    automated match to d2glza1
    complexed with edo, ni, zn

Details for d2glzb_

PDB Entry: 2glz (more details), 1.45 Å

PDB Description: Crystal structure of a formylmethanofuran dehydrogenase subunit e-like protein (dhaf_2992) from desulfitobacterium hafniense dcb-2 at 1.45 A resolution
PDB Compounds: (B:) similar to Formylmethanofuran dehydrogenase subunit E

SCOPe Domain Sequences for d2glzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glzb_ d.81.3.1 (B:) FwdE-like protein DSY1837 (Dhaf_2201) {Desulfitobacterium hafniense [TaxId: 49338]}
ektpwelvidfhghtcpdialgyriaqlaqremgirpapdseclvkaytqscaldaiqvl
nkatigrhaliieethrymyqfhftgtqdihqftvspavldhletlrhpdlsprerqnkv
legvqyvltleesafchydkipgqlski

SCOPe Domain Coordinates for d2glzb_:

Click to download the PDB-style file with coordinates for d2glzb_.
(The format of our PDB-style files is described here.)

Timeline for d2glzb_: