SCOPe 2.06: Domain d2glza1: 2glz A:3-151

Lineage for d2glza1 (2glz A:3-151)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.3: FwdE-like [143555] (1 family)
   contains extra N-terminal and C-terminal structures
   automatically mapped to Pfam PF02663

5. Family d.81.3.1: FwdE-like [143556] (2 proteins)
   Pfam PF02663; Tungsten formylmethanofuran dehydrogenase, subunit E, FwdE, is a stand-alone domain of this fold

6. Protein FwdE-like protein DSY1837 (Dhaf_2201) [143557] (1 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [143558] (1 PDB entry)
   Uniprot Q24WG6 3-151

8. Domain d2glza1: 2glz A:3-151 [135348]
   complexed with edo, ni, zn

Details for d2glza1

PDB Entry: 2glz, 1.45 Å

PDB Description: Crystal structure of a formylmethanofuran dehydrogenase subunit e-like protein (dhaf_2992) from desulfitobacterium hafniense dcb-2 at 1.45 A resolution

PDB Compounds: (A:) similar to Formylmethanofuran dehydrogenase subunit E

SCOPe Domain Sequences for d2glza1:

Sequence; same for both SEQRES and ATOM records:

>d2glza1 d.81.3.1 (A:3-151) FwdE-like protein DSY1837 (Dhaf_2201) {Desulfitobacterium hafniense [TaxId: 49338]}
vektpwelvidfhghtcpdialgyriaqlaqremgirpapdseclvkaytqscaldaiqv
lnkatigrhaliieethrymyqfhftgtqdihqftvspavldhletlrhpdlsprerqnk
vlegvqyvltleesafchydkipgqlski

Timeline for d2glza1:

• d2glza1 first appeared in SCOP 1.73
  
• d2glza1 appears in SCOPe 2.05
  
• d2glza1 appears in SCOPe 2.07
  
• d2glza1 appears in the current release, SCOPe 2.08