Lineage for d2glub2 (2glu B:0-228)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130268Family c.66.1.41: UbiE/COQ5-like [110671] (5 protein domains)
    Pfam PF01209
  6. 2130287Protein Hypothetical protein YcgJ [117683] (1 species)
  7. 2130288Species Bacillus subtilis [TaxId:1423] [117684] (2 PDB entries)
    Uniprot O31474
  8. 2130292Domain d2glub2: 2glu B:0-228 [135347]
    Other proteins in same PDB: d2glua2, d2glua3, d2glub3, d2glub4
    automated match to d1xxla_
    complexed with sam, so4

Details for d2glub2

PDB Entry: 2glu (more details), 2.91 Å

PDB Description: The crystal structure of YcgJ protein from Bacillus subitilis
PDB Compounds: (B:) ycgJ

SCOPe Domain Sequences for d2glub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glub2 c.66.1.41 (B:0-228) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}
slglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqekgv
envrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdhyap
edpvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswikrgg
tpadrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikr

SCOPe Domain Coordinates for d2glub2:

Click to download the PDB-style file with coordinates for d2glub2.
(The format of our PDB-style files is described here.)

Timeline for d2glub2: