SCOPe 2.08: Domain d2glub2: 2glu B:0-228

Lineage for d2glub2 (2glu B:0-228)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
   Pfam PF01209

6. Protein Hypothetical protein YcgJ [117683] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117684] (2 PDB entries)
   Uniprot O31474

8. Domain d2glub2: 2glu B:0-228 [135347]
   Other proteins in same PDB: d2glua2, d2glua3, d2glub3, d2glub4
   automated match to d1xxla_
   complexed with sam, so4

Details for d2glub2

PDB Entry: 2glu, 2.91 Å

PDB Description: the crystal structure of ycgj protein from bacillus subitilis

PDB Compounds: (B:) ycgJ

SCOPe Domain Sequences for d2glub2:

Sequence; same for both SEQRES and ATOM records:

>d2glub2 c.66.1.41 (B:0-228) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}
slglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqekgv
envrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdhyap
edpvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswikrgg
tpadrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikr

Timeline for d2glub2:

• d2glub2 first appeared in SCOP 1.73, called d2glub1
  
• d2glub2 appears in SCOPe 2.07