Lineage for d2glqa_ (2glq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905606Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2905607Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2905608Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2905715Protein automated matches [190176] (2 species)
    not a true protein
  7. 2905716Species Human (Homo sapiens) [TaxId:9606] [186907] (7 PDB entries)
  8. 2905718Domain d2glqa_: 2glq A: [135345]
    automated match to d1ew2a_
    complexed with mg, nag, sr, zn

Details for d2glqa_

PDB Entry: 2glq (more details), 1.6 Å

PDB Description: x-ray structure of human alkaline phosphatase in complex with strontium
PDB Compounds: (A:) Alkaline phosphatase, placental type

SCOPe Domain Sequences for d2glqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glqa_ c.76.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlapp

SCOPe Domain Coordinates for d2glqa_:

Click to download the PDB-style file with coordinates for d2glqa_.
(The format of our PDB-style files is described here.)

Timeline for d2glqa_: