![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily) core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest |
![]() | Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) ![]() |
![]() | Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins) common fold is decorated with several large insertions automatically mapped to Pfam PF00245 |
![]() | Protein automated matches [190176] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186907] (7 PDB entries) |
![]() | Domain d2glqa_: 2glq A: [135345] automated match to d1ew2a_ complexed with mg, nag, sr, zn |
PDB Entry: 2glq (more details), 1.6 Å
SCOPe Domain Sequences for d2glqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glqa_ c.76.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlapp
Timeline for d2glqa_: