Lineage for d2glka_ (2glk A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447626Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2447677Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2447931Protein automated matches [190298] (3 species)
    not a true protein
  7. 2447941Species Streptomyces rubiginosus [TaxId:1929] [187248] (15 PDB entries)
  8. 2447944Domain d2glka_: 2glk A: [135344]
    automated match to d1dxia_
    complexed with gol, mn

Details for d2glka_

PDB Entry: 2glk (more details), 0.94 Å

PDB Description: high-resolution study of d-xylose isomerase, 0.94a resolution.
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d2glka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glka_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d2glka_:

Click to download the PDB-style file with coordinates for d2glka_.
(The format of our PDB-style files is described here.)

Timeline for d2glka_: