Lineage for d2gl7a1 (2gl7 A:143-663)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775278Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 775279Protein beta-Catenin [48373] (2 species)
  7. 775280Species Human (Homo sapiens) [TaxId:9606] [48375] (9 PDB entries)
    Uniprot P35222 145-664
  8. 775290Domain d2gl7a1: 2gl7 A:143-663 [135340]
    automatically matched to d1g3ja_
    mutant

Details for d2gl7a1

PDB Entry: 2gl7 (more details), 2.6 Å

PDB Description: crystal structure of a beta-catenin/bcl9/tcf4 complex
PDB Compounds: (A:) beta-catenin

SCOP Domain Sequences for d2gl7a1:

Sequence, based on SEQRES records: (download)

>d2gl7a1 a.118.1.1 (A:143-663) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
qddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtm
qntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnl
llhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpq
alvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqncl
wtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvg
giealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpps
hwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfve
gvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcela
qdkeaaeaieaegatapltellhsrnegvatyaaavlfrms

Sequence, based on observed residues (ATOM records): (download)

>d2gl7a1 a.118.1.1 (A:143-663) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
qddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtm
qntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnl
llhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpq
alvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqncl
wtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvg
giealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpps
hwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrfvegvrmeeiveg
ctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaie
aegatapltellhsrnegvatyaaavlfrms

SCOP Domain Coordinates for d2gl7a1:

Click to download the PDB-style file with coordinates for d2gl7a1.
(The format of our PDB-style files is described here.)

Timeline for d2gl7a1: