Lineage for d2gl7a_ (2gl7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
  6. 2332677Protein beta-Catenin [48373] (2 species)
  7. 2332678Species Human (Homo sapiens) [TaxId:9606] [48375] (10 PDB entries)
    Uniprot P35222 145-664
  8. 2332686Domain d2gl7a_: 2gl7 A: [135340]
    automated match to d1jdha_

Details for d2gl7a_

PDB Entry: 2gl7 (more details), 2.6 Å

PDB Description: Crystal Structure of a beta-catenin/BCL9/Tcf4 complex
PDB Compounds: (A:) beta-catenin

SCOPe Domain Sequences for d2gl7a_:

Sequence, based on SEQRES records: (download)

>d2gl7a_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
eqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrt
mqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhn
lllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggp
qalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnc
lwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqv
ggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpp
shwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfv
egvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcel
aqdkeaaeaieaegatapltellhsrnegvatyaaavlfrms

Sequence, based on observed residues (ATOM records): (download)

>d2gl7a_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
eqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrt
mqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhn
lllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggp
qalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnc
lwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqv
ggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpp
shwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrfvegvrmeeive
gctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeai
eaegatapltellhsrnegvatyaaavlfrms

SCOPe Domain Coordinates for d2gl7a_:

Click to download the PDB-style file with coordinates for d2gl7a_.
(The format of our PDB-style files is described here.)

Timeline for d2gl7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gl7d_