SCOP 1.73: Domain d2gl5b2: 2gl5 B:1-122

Lineage for d2gl5b2 (2gl5 B:1-122)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Putative dehydratase protein STM2273 [143250] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [143251] (1 PDB entry)

8. Domain d2gl5b2: 2gl5 B:1-122 [135339]
   Other proteins in same PDB: d2gl5a1, d2gl5b1
   automatically matched to 2GL5 A:1-122
   complexed with gol, mg; mutant

Details for d2gl5b2

PDB Entry: 2gl5, 1.6 Å

PDB Description: crystal structure of putative dehydratase from salmonella thyphimurium

PDB Compounds: (B:) putative dehydratase protein

SCOP Domain Sequences for d2gl5b2:

Sequence; same for both SEQRES and ATOM records:

>d2gl5b2 d.54.1.1 (B:1-122) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 602]}
lkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiirdl
aplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyqll
gg

Timeline for d2gl5b2:

• d2gl5b2 is new in SCOP 1.73
  
• d2gl5b2 appears in SCOP 1.75
  
• d2gl5b2 appears in the current release, SCOPe 2.08