Lineage for d2gl5a1 (2gl5 A:123-400)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817947Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 818012Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 818180Protein Putative dehydratase protein STM2273 [141846] (1 species)
  7. 818181Species Salmonella typhimurium [TaxId:90371] [141847] (1 PDB entry)
    Uniprot Q8ZNH1 123-400
  8. 818182Domain d2gl5a1: 2gl5 A:123-400 [135336]
    Other proteins in same PDB: d2gl5a2, d2gl5b2
    complexed with gol, mg; mutant

Details for d2gl5a1

PDB Entry: 2gl5 (more details), 1.6 Å

PDB Description: crystal structure of putative dehydratase from salmonella thyphimurium
PDB Compounds: (A:) putative dehydratase protein

SCOP Domain Sequences for d2gl5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]}
ktneklrtyasqlqfgwgdknhilvtpeeyaeaaraalddgydaikvdpleidrngddcv
fqnrnrnysgllladqlkmgeariaamreamgddadiiveihsllgtnsaiqfakaieky
riflyeepihplnsdnmqkvsrsttipiatgersytrwgyrellekqsiavaqpdlclcg
gitegkkicdyaniydttvqvhvcggpvstvaalhmetaipnfiihehhtnamkasirel
cthdyqpengyyvapeqpglgqelndevvkeylayvik

SCOP Domain Coordinates for d2gl5a1:

Click to download the PDB-style file with coordinates for d2gl5a1.
(The format of our PDB-style files is described here.)

Timeline for d2gl5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gl5a2