Lineage for d2gkve1 (2gkv E:16-242)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802047Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)
  6. 802125Protein Protease B [50508] (1 species)
  7. 802126Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (28 PDB entries)
    Streptogrisin B
  8. 802142Domain d2gkve1: 2gkv E:16-242 [135335]
    automatically matched to d1sgde_
    mutant

Details for d2gkve1

PDB Entry: 2gkv (more details), 1.7 Å

PDB Description: Crystal structure of the SGPB:P14'-Ala32 OMTKY3-del(1-5) complex
PDB Compounds: (E:) Streptogrisin B

SCOP Domain Sequences for d2gkve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkve1 b.47.1.1 (E:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

SCOP Domain Coordinates for d2gkve1:

Click to download the PDB-style file with coordinates for d2gkve1.
(The format of our PDB-style files is described here.)

Timeline for d2gkve1: