Lineage for d2gkla_ (2gkl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996668Species Aeromonas hydrophila, CphA [TaxId:644] [118144] (11 PDB entries)
    Uniprot P26918 28-252
  8. 2996674Domain d2gkla_: 2gkl A: [135333]
    automated match to d1x8ha_
    complexed with gol, pd2, zn

Details for d2gkla_

PDB Entry: 2gkl (more details), 1.86 Å

PDB Description: Crystal structure of the zinc carbapenemase CPHA in complex with the inhibitor pyridine-2,4-dicarboxylate
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2gkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkla_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}
agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlygncilkeklgnlsfadv
kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaap

SCOPe Domain Coordinates for d2gkla_:

Click to download the PDB-style file with coordinates for d2gkla_.
(The format of our PDB-style files is described here.)

Timeline for d2gkla_: