| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
| Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein) automatically mapped to Pfam PF01678 |
| Protein Diaminopimelate epimerase [54508] (3 species) |
| Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries) |
| Domain d2gkja2: 2gkj A:131-274 [135332] automated match to d1gqza2 complexed with acy, zdr |
PDB Entry: 2gkj (more details), 1.7 Å
SCOPe Domain Sequences for d2gkja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkja2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl
Timeline for d2gkja2: