Lineage for d2gkja1 (2gkj A:1-130)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898719Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1898720Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1898721Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
    automatically mapped to Pfam PF01678
  6. 1898722Protein Diaminopimelate epimerase [54508] (3 species)
  7. 1898732Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. 1898735Domain d2gkja1: 2gkj A:1-130 [135331]
    automated match to d1gqza1
    complexed with acy, zdr

Details for d2gkja1

PDB Entry: 2gkj (more details), 1.7 Å

PDB Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor DL-AZIDAP
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2gkja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkja1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
piwepakipf

SCOPe Domain Coordinates for d2gkja1:

Click to download the PDB-style file with coordinates for d2gkja1.
(The format of our PDB-style files is described here.)

Timeline for d2gkja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gkja2