![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein) |
![]() | Protein Diaminopimelate epimerase [54508] (1 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [54509] (4 PDB entries) |
![]() | Domain d2gkja1: 2gkj A:1-130 [135331] automatically matched to d1bwza1 complexed with acy, zdr |
PDB Entry: 2gkj (more details), 1.7 Å
SCOP Domain Sequences for d2gkja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkja1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]} mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge piwepakipf
Timeline for d2gkja1: