SCOP 1.73: Domain d2gkja1: 2gkj A:1-130

Lineage for d2gkja1 (2gkj A:1-130)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)

6. Protein Diaminopimelate epimerase [54508] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [54509] (4 PDB entries)

8. Domain d2gkja1: 2gkj A:1-130 [135331]
   automatically matched to d1bwza1
   complexed with acy, zdr

Details for d2gkja1

PDB Entry: 2gkj, 1.7 Å

PDB Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor DL-AZIDAP

PDB Compounds: (A:) Diaminopimelate epimerase

SCOP Domain Sequences for d2gkja1:

Sequence; same for both SEQRES and ATOM records:

>d2gkja1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
piwepakipf

Timeline for d2gkja1:

• d2gkja1 is new in SCOP 1.73
  
• d2gkja1 appears in SCOP 1.75
  
• d2gkja1 appears in the current release, SCOPe 2.08