SCOPe 2.08: Domain d2gkea2: 2gke A:131-274

Lineage for d2gkea2 (2gke A:131-274)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (3 species)

7. Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)

8. Domain d2gkea2: 2gke A:131-274 [135330]
   automated match to d1gqza2
   complexed with acy, gol, zdp

Details for d2gkea2

PDB Entry: 2gke, 1.35 Å

PDB Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor LL-AziDAP

PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2gkea2:

Sequence; same for both SEQRES and ATOM records:

>d2gkea2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

Timeline for d2gkea2:

• d2gkea2 first appeared in SCOP 1.73
  
• d2gkea2 appears in SCOPe 2.07