Lineage for d2gkea1 (2gke A:1-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546596Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. 2546597Protein Diaminopimelate epimerase [54508] (3 species)
  7. 2546607Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. 2546608Domain d2gkea1: 2gke A:1-130 [135329]
    automated match to d1gqza1
    complexed with acy, gol, zdp

Details for d2gkea1

PDB Entry: 2gke (more details), 1.35 Å

PDB Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor LL-AziDAP
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2gkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkea1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
piwepakipf

SCOPe Domain Coordinates for d2gkea1:

Click to download the PDB-style file with coordinates for d2gkea1.
(The format of our PDB-style files is described here.)

Timeline for d2gkea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gkea2