Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins) automatically mapped to Pfam PF01678 |
Protein Diaminopimelate epimerase [54508] (3 species) |
Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries) |
Domain d2gkea1: 2gke A:1-130 [135329] automated match to d1gqza1 complexed with acy, gol, zdp |
PDB Entry: 2gke (more details), 1.35 Å
SCOPe Domain Sequences for d2gkea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkea1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]} mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge piwepakipf
Timeline for d2gkea1: