SCOPe 2.08: Domain d2gkda_: 2gkd A:

Lineage for d2gkda_ (2gkd A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein Calicheamicin gene cluster protein CalC [143831] (1 species)
   possible link between the AHSA1 (Pfam PF08327) and oligoketide cyclase/dehydrase-like (new Pfam PF03364) families

7. Species Micromonospora echinospora [TaxId:1877] [143832] (4 PDB entries)
   Uniprot Q8KNF0 27-181

8. Domain d2gkda_: 2gkd A: [135328]
   automated match to d2l65a1
   protein/DNA complex

Details for d2gkda_

PDB Entry: 2gkd

PDB Description: structural insight into self-sacrifice mechanism of enediyne resistance

PDB Compounds: (A:) CalC

SCOPe Domain Sequences for d2gkda_:

Sequence; same for both SEQRES and ATOM records:

>d2gkda_ d.129.3.5 (A:) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]}
nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg
eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr
mgtkhakrvrngmdkgwptilqsfqdkideegakk

Timeline for d2gkda_:

• d2gkda_ first appeared in SCOP 1.73, called d2gkda1
  
• d2gkda_ appears in SCOPe 2.07