SCOP 1.75: Domain d2gk1b2: 2gk1 B:54-199

Lineage for d2gk1b2 (2gk1 B:54-199)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
   family GH20

6. Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)

8. Domain d2gk1b2: 2gk1 B:54-199 [135320]
   Other proteins in same PDB: d2gk1a1, d2gk1a2, d2gk1b1, d2gk1c1, d2gk1c2, d2gk1d1, d2gk1e1, d2gk1e2, d2gk1f1, d2gk1g1, d2gk1g2, d2gk1h1
   automatically matched to d1o7aa2
   complexed with bma, nag, ngt

Details for d2gk1b2

PDB Entry: 2gk1, 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa

PDB Compounds: (B:) beta-hexosaminidase beta chain

SCOP Domain Sequences for d2gk1b2:

Sequence, based on SEQRES records:

>d2gk1b2 d.92.2.1 (B:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records):

>d2gk1b2 d.92.2.1 (B:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

Timeline for d2gk1b2:

• d2gk1b2 first appeared in SCOP 1.73
  
• d2gk1b2 appears in SCOPe 2.01
  
• d2gk1b2 last appears in SCOPe 2.06