Lineage for d2gjxg2 (2gjx G:54-199)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2530337Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2530338Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 2530355Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
  7. 2530356Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)
  8. 2530372Domain d2gjxg2: 2gjx G:54-199 [135318]
    Other proteins in same PDB: d2gjxa1, d2gjxa2, d2gjxb1, d2gjxc1, d2gjxd1, d2gjxd2, d2gjxe1, d2gjxe2, d2gjxf1, d2gjxg1, d2gjxh1, d2gjxh2
    automated match to d1np0a2
    complexed with bma, nag, ndg, so4

Details for d2gjxg2

PDB Entry: 2gjx (more details), 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a
PDB Compounds: (G:) beta-hexosaminidase beta chain

SCOPe Domain Sequences for d2gjxg2:

Sequence, based on SEQRES records: (download)

>d2gjxg2 d.92.2.1 (G:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records): (download)

>d2gjxg2 d.92.2.1 (G:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

SCOPe Domain Coordinates for d2gjxg2:

Click to download the PDB-style file with coordinates for d2gjxg2.
(The format of our PDB-style files is described here.)

Timeline for d2gjxg2: