Lineage for d2gjxf2 (2gjx F:54-199)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729626Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 729627Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (3 proteins)
    family GH20
  6. 729634Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
  7. 729635Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)
  8. 729650Domain d2gjxf2: 2gjx F:54-199 [135316]
    Other proteins in same PDB: d2gjxb1, d2gjxc1, d2gjxf1, d2gjxg1
    automatically matched to d1o7aa2
    complexed with bma, nag, ndg, so4

Details for d2gjxf2

PDB Entry: 2gjx (more details), 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a
PDB Compounds: (F:) beta-hexosaminidase beta chain

SCOP Domain Sequences for d2gjxf2:

Sequence, based on SEQRES records: (download)

>d2gjxf2 d.92.2.1 (F:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records): (download)

>d2gjxf2 d.92.2.1 (F:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

SCOP Domain Coordinates for d2gjxf2:

Click to download the PDB-style file with coordinates for d2gjxf2.
(The format of our PDB-style files is described here.)

Timeline for d2gjxf2: