Lineage for d2gjxc1 (2gjx C:200-552)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683441Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (4 protein domains)
    Glycosyl hydrolase family 20, GH20
  6. 683448Protein beta-hexosaminidase B [89486] (1 species)
  7. 683449Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)
  8. 683463Domain d2gjxc1: 2gjx C:200-552 [135313]
    Other proteins in same PDB: d2gjxb2, d2gjxc2, d2gjxf2, d2gjxg2
    automatically matched to d1o7aa1
    complexed with bma, nag, ndg, so4

Details for d2gjxc1

PDB Entry: 2gjx (more details), 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a
PDB Compounds: (C:) beta-hexosaminidase beta chain

SCOP Domain Sequences for d2gjxc1:

Sequence, based on SEQRES records: (download)

>d2gjxc1 c.1.8.6 (C:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysrqnkldsf
gpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtd
fkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtas
gfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnlt
prlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

Sequence, based on observed residues (ATOM records): (download)

>d2gjxc1 c.1.8.6 (C:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysldsfgpin
ptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkkl
esfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfpv
ilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprlw
prasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

SCOP Domain Coordinates for d2gjxc1:

Click to download the PDB-style file with coordinates for d2gjxc1.
(The format of our PDB-style files is described here.)

Timeline for d2gjxc1: