Lineage for d2gjxc1 (2gjx C:200-552)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083407Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 protein domains)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2083424Protein beta-hexosaminidase B [89486] (1 species)
  7. 2083425Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)
  8. 2083439Domain d2gjxc1: 2gjx C:200-552 [135313]
    Other proteins in same PDB: d2gjxa1, d2gjxa2, d2gjxb2, d2gjxc2, d2gjxd1, d2gjxd2, d2gjxe1, d2gjxe2, d2gjxf2, d2gjxg2, d2gjxh1, d2gjxh2
    automated match to d1np0a1
    complexed with nag, so4

Details for d2gjxc1

PDB Entry: 2gjx (more details), 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a
PDB Compounds: (C:) beta-hexosaminidase beta chain

SCOPe Domain Sequences for d2gjxc1:

Sequence, based on SEQRES records: (download)

>d2gjxc1 c.1.8.6 (C:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysrqnkldsf
gpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtd
fkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtas
gfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnlt
prlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

Sequence, based on observed residues (ATOM records): (download)

>d2gjxc1 c.1.8.6 (C:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysldsfgpin
ptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkkl
esfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfpv
ilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprlw
prasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

SCOPe Domain Coordinates for d2gjxc1:

Click to download the PDB-style file with coordinates for d2gjxc1.
(The format of our PDB-style files is described here.)

Timeline for d2gjxc1: