| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) ![]() |
| Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins) |
| Protein Dimeric tRNA splicing endonuclease, domains 2 and 4 [102477] (1 species) duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats |
| Species Archaeoglobus fulgidus [TaxId:2234] [102478] (4 PDB entries) |
| Domain d2gjwd2: 2gjw D:218-308 [135308] Other proteins in same PDB: d2gjwa3, d2gjwa4, d2gjwa5, d2gjwb3, d2gjwb4, d2gjwb5, d2gjwc3, d2gjwc4, d2gjwc5, d2gjwd3, d2gjwd4 automatically matched to d1r0va2 protein/RNA complex |
PDB Entry: 2gjw (more details), 2.85 Å
SCOPe Domain Sequences for d2gjwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjwd2 c.52.2.1 (D:218-308) Dimeric tRNA splicing endonuclease, domains 2 and 4 {Archaeoglobus fulgidus [TaxId: 2234]}
nfdrryevyrnlkergfvvktgfkfgsefrvyrkvesvddlphseylvdiadsreirlid
laravrlaqnvrkrmvfaygknylcfervkv
Timeline for d2gjwd2: