SCOP 1.73: Domain d2gjwc4: 2gjw C:142-216

Lineage for d2gjwc4 (2gjw C:142-216)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family)

5. Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)

6. Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species)
   duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries)

8. Domain d2gjwc4: 2gjw C:142-216 [135306]
   Other proteins in same PDB: d2gjwa1, d2gjwa2, d2gjwb1, d2gjwb2, d2gjwc1, d2gjwc2, d2gjwd1, d2gjwd2
   automatically matched to d1r0va3
   complexed with a23, du

Details for d2gjwc4

PDB Entry: 2gjw, 2.85 Å

PDB Description: RNA Recognition and Cleavage by an Splicing Endonuclease

PDB Compounds: (C:) tRNA-splicing endonuclease

SCOP Domain Sequences for d2gjwc4:

Sequence; same for both SEQRES and ATOM records:

>d2gjwc4 d.75.1.1 (C:142-216) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
geqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtlslieslylldlgklnlln
adreelvkrarever

Timeline for d2gjwc4:

• d2gjwc4 is new in SCOP 1.73
  
• d2gjwc4 appears in SCOP 1.75
  
• d2gjwc4 appears in the current release, SCOPe 2.08