![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) ![]() |
![]() | Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins) |
![]() | Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species) duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries) |
![]() | Domain d2gjwc4: 2gjw C:142-216 [135306] Other proteins in same PDB: d2gjwa1, d2gjwa2, d2gjwb1, d2gjwb2, d2gjwc1, d2gjwc2, d2gjwd1, d2gjwd2 automatically matched to d1r0va3 complexed with a23, du |
PDB Entry: 2gjw (more details), 2.85 Å
SCOP Domain Sequences for d2gjwc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjwc4 d.75.1.1 (C:142-216) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} geqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtlslieslylldlgklnlln adreelvkrarever
Timeline for d2gjwc4: