Lineage for d2gjwb1 (2gjw B:63-141)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700831Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 701157Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) (S)
  5. 701158Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (2 proteins)
  6. 701159Protein Dimeric tRNA splicing endonuclease, domains 2 and 4 [102477] (1 species)
    duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats
  7. 701160Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102478] (4 PDB entries)
  8. 701175Domain d2gjwb1: 2gjw B:63-141 [135299]
    Other proteins in same PDB: d2gjwa3, d2gjwa4, d2gjwb3, d2gjwb4, d2gjwc3, d2gjwc4, d2gjwd3, d2gjwd4
    automatically matched to d1r11a1
    complexed with a23, du

Details for d2gjwb1

PDB Entry: 2gjw (more details), 2.85 Å

PDB Description: RNA Recognition and Cleavage by an Splicing Endonuclease
PDB Compounds: (B:) tRNA-splicing endonuclease

SCOP Domain Sequences for d2gjwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjwb1 c.52.2.1 (B:63-141) Dimeric tRNA splicing endonuclease, domains 2 and 4 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
vvdeeseityfrvyepdmm

SCOP Domain Coordinates for d2gjwb1:

Click to download the PDB-style file with coordinates for d2gjwb1.
(The format of our PDB-style files is described here.)

Timeline for d2gjwb1: