![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rad [142295] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142296] (1 PDB entry) Uniprot P55042 91-258 |
![]() | Domain d2gjsa1: 2gjs A:91-258 [135287] Other proteins in same PDB: d2gjsb_ complexed with gdp, mg |
PDB Entry: 2gjs (more details), 1.9 Å
SCOPe Domain Sequences for d2gjsa1:
Sequence, based on SEQRES records: (download)
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} vykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqdg grwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvrs revsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrdsk
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} vykvlllgapgvgksalarifggvghtydrsivvdgeeaslmvydiwlpghcmamgdayv ivysvtdkgsfekaselrvqlrrarqdvpiilvgnksdlvrsrevsvdegracavvfdck fietsaalhhnvqalfegvvrqirlrrdsk
Timeline for d2gjsa1: