Lineage for d2gjra2 (2gjr A:5-395)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830350Species Bacillus halmapalus [TaxId:79882] [255187] (2 PDB entries)
  8. 2830352Domain d2gjra2: 2gjr A:5-395 [135286]
    Other proteins in same PDB: d2gjra1
    automated match to d1ud2a2
    complexed with act, ca, na

Details for d2gjra2

PDB Entry: 2gjr (more details), 2.1 Å

PDB Description: structure of bacillus halmapalus alpha-amylase without any substrate analogues
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d2gjra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjra2 c.1.8.1 (A:5-395) automated matches {Bacillus halmapalus [TaxId: 79882]}
tngtmmqyfewhlpndgqhwnrlrddasnlrnrgitaiwippawkgtsqndvgygaydly
dlgefnqkgtvrtkygtrsqlesaihalknngvqvygdvvmnhkggadatenvlavevnp
nnrnqeisgdytieawtkfdfpgrgntysdfkwrwyhfdgvdwdqsrqfqnriykfrgdg
kawdwevdsengnydylmyadvdmdhpevvnelrrwgewytntlnldgfridavkhikys
ftrdwlthvrnatgkemfavaefwkndlgalenylnktnwnhsvfdvplhynlynasnsg
gnydmakllngtvvqkhpmhavtfvdnhdsqpgeslesfvqewfkplayaliltreqgyp
svfygdyygipthsvpamkakidpilearqn

SCOPe Domain Coordinates for d2gjra2:

Click to download the PDB-style file with coordinates for d2gjra2.
(The format of our PDB-style files is described here.)

Timeline for d2gjra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gjra1