| Class b: All beta proteins [48724] (176 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
| Protein automated matches [226835] (27 species) not a true protein |
| Species Bacillus halmapalus [TaxId:79882] [255188] (2 PDB entries) |
| Domain d2gjra1: 2gjr A:396-485 [135285] Other proteins in same PDB: d2gjra2 automated match to d1ud2a1 complexed with act, ca, na |
PDB Entry: 2gjr (more details), 2.1 Å
SCOPe Domain Sequences for d2gjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjra1 b.71.1.0 (A:396-485) automated matches {Bacillus halmapalus [TaxId: 79882]}
faygtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhdit
gnkpgtvtinadgwanfsvnggsvsiwvkr
Timeline for d2gjra1: