Lineage for d2gjpa2 (2gjp A:5-395)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2439016Protein automated matches [190099] (33 species)
    not a true protein
  7. 2439023Species Bacillus halmapalus [TaxId:79882] [255187] (2 PDB entries)
  8. 2439024Domain d2gjpa2: 2gjp A:5-395 [135284]
    Other proteins in same PDB: d2gjpa1
    automated match to d1ud2a2
    complexed with ca, glc, mal, na

Details for d2gjpa2

PDB Entry: 2gjp (more details), 1.9 Å

PDB Description: structure of bacillus halmapalus alpha-amylase, crystallized with the substrate analogue acarbose and maltose
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d2gjpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjpa2 c.1.8.1 (A:5-395) automated matches {Bacillus halmapalus [TaxId: 79882]}
tngtmmqyfewhlpndgqhwnrlrddasnlrnrgitaiwippawkgtsqndvgygaydly
dlgefnqkgtvrtkygtrsqlesaihalknngvqvygdvvmnhkggadatenvlavevnp
nnrnqeisgdytieawtkfdfpgrgntysdfkwrwyhfdgvdwdqsrqfqnriykfrgdg
kawdwevdsengnydylmyadvdmdhpevvnelrrwgewytntlnldgfridavkhikys
ftrdwlthvrnatgkemfavaefwkndlgalenylnktnwnhsvfdvplhynlynasnsg
gnydmakllngtvvqkhpmhavtfvdnhdsqpgeslesfvqewfkplayaliltreqgyp
svfygdyygipthsvpamkakidpilearqn

SCOPe Domain Coordinates for d2gjpa2:

Click to download the PDB-style file with coordinates for d2gjpa2.
(The format of our PDB-style files is described here.)

Timeline for d2gjpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gjpa1