SCOPe 2.08: Domain d2gjpa2: 2gjp A:5-395

Lineage for d2gjpa2 (2gjp A:5-395)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (31 species)
   not a true protein

7. Species Bacillus halmapalus [TaxId:79882] [255187] (2 PDB entries)

8. Domain d2gjpa2: 2gjp A:5-395 [135284]
   Other proteins in same PDB: d2gjpa1
   automated match to d1ud2a2
   complexed with ca, glc, na

Details for d2gjpa2

PDB Entry: 2gjp, 1.9 Å

PDB Description: structure of bacillus halmapalus alpha-amylase, crystallized with the substrate analogue acarbose and maltose

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d2gjpa2:

Sequence; same for both SEQRES and ATOM records:

>d2gjpa2 c.1.8.1 (A:5-395) automated matches {Bacillus halmapalus [TaxId: 79882]}
tngtmmqyfewhlpndgqhwnrlrddasnlrnrgitaiwippawkgtsqndvgygaydly
dlgefnqkgtvrtkygtrsqlesaihalknngvqvygdvvmnhkggadatenvlavevnp
nnrnqeisgdytieawtkfdfpgrgntysdfkwrwyhfdgvdwdqsrqfqnriykfrgdg
kawdwevdsengnydylmyadvdmdhpevvnelrrwgewytntlnldgfridavkhikys
ftrdwlthvrnatgkemfavaefwkndlgalenylnktnwnhsvfdvplhynlynasnsg
gnydmakllngtvvqkhpmhavtfvdnhdsqpgeslesfvqewfkplayaliltreqgyp
svfygdyygipthsvpamkakidpilearqn

Timeline for d2gjpa2:

• d2gjpa2 first appeared in SCOP 1.73
  
• d2gjpa2 appears in SCOPe 2.07