![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Bacillus halmapalus [TaxId:79882] [255188] (2 PDB entries) |
![]() | Domain d2gjpa1: 2gjp A:396-485 [135283] Other proteins in same PDB: d2gjpa2 automated match to d1ud2a1 complexed with ca, glc, mal, na |
PDB Entry: 2gjp (more details), 1.9 Å
SCOPe Domain Sequences for d2gjpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjpa1 b.71.1.0 (A:396-485) automated matches {Bacillus halmapalus [TaxId: 79882]} faygtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhdit gnkpgtvtinadgwanfsvnggsvsiwvkr
Timeline for d2gjpa1: