SCOPe 2.07: Domain d2gjpa1: 2gjp A:396-485

Lineage for d2gjpa1 (2gjp A:396-485)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Bacillus halmapalus [TaxId:79882] [255188] (2 PDB entries)

8. Domain d2gjpa1: 2gjp A:396-485 [135283]
   Other proteins in same PDB: d2gjpa2
   automated match to d1ud2a1
   complexed with ca, glc, mal, na

Details for d2gjpa1

PDB Entry: 2gjp, 1.9 Å

PDB Description: structure of bacillus halmapalus alpha-amylase, crystallized with the substrate analogue acarbose and maltose

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d2gjpa1:

Sequence; same for both SEQRES and ATOM records:

>d2gjpa1 b.71.1.0 (A:396-485) automated matches {Bacillus halmapalus [TaxId: 79882]}
faygtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhdit
gnkpgtvtinadgwanfsvnggsvsiwvkr

Timeline for d2gjpa1:

• d2gjpa1 first appeared in SCOP 1.73
  
• d2gjpa1 appears in SCOPe 2.06
  
• d2gjpa1 appears in the current release, SCOPe 2.08