Lineage for d2gjpa1 (2gjp A:399-485)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808243Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 808248Species Bacillus halmapalus [TaxId:79882] [141551] (3 PDB entries)
    Uniprot P19571 432-518
  8. 808249Domain d2gjpa1: 2gjp A:399-485 [135283]
    Other proteins in same PDB: d2gjpa2
    automatically matched to 1W9X A:399-485
    complexed with bgc, ca, daf, glc, mal, na

Details for d2gjpa1

PDB Entry: 2gjp (more details), 1.9 Å

PDB Description: structure of bacillus halmapalus alpha-amylase, crystallized with the substrate analogue acarbose and maltose
PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d2gjpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjpa1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus halmapalus [TaxId: 79882]}
gtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhditgnk
pgtvtinadgwanfsvnggsvsiwvkr

SCOP Domain Coordinates for d2gjpa1:

Click to download the PDB-style file with coordinates for d2gjpa1.
(The format of our PDB-style files is described here.)

Timeline for d2gjpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gjpa2