SCOPe 2.08: Domain d2gjaa2: 2gja A:216-382

Lineage for d2gjaa2 (2gja A:216-382)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [187117] (4 PDB entries)

8. Domain d2gjaa2: 2gja A:216-382 [135278]
   Other proteins in same PDB: d2gjaa3, d2gjab3
   automated match to d1rfla_
   complexed with alf, gdp, mg, nh4

Details for d2gjaa2

PDB Entry: 2gja, 1.85 Å

PDB Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and NH4+

PDB Compounds: (A:) tRNA modification GTPase trmE

SCOPe Domain Sequences for d2gjaa2:

Sequence; same for both SEQRES and ATOM records:

>d2gjaa2 c.37.1.8 (A:216-382) automated matches {Escherichia coli [TaxId: 469008]}
gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr
easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn
kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnm

Timeline for d2gjaa2:

• d2gjaa2 first appeared in SCOP 1.73, called d2gjaa1
  
• d2gjaa2 appears in SCOPe 2.07