SCOPe 2.03: Domain d2gj9d_: 2gj9 D:

Lineage for d2gj9d_ (2gj9 D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [187117] (3 PDB entries)

8. Domain d2gj9d_: 2gj9 D: [135277]
   automated match to d1rfla_
   complexed with alf, gdp, mg, rb

Details for d2gj9d_

PDB Entry: 2gj9, 2 Å

PDB Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and Rb+

PDB Compounds: (D:) tRNA modification GTPase trmE

SCOPe Domain Sequences for d2gj9d_:

Sequence; same for both SEQRES and ATOM records:

>d2gj9d_ c.37.1.8 (D:) automated matches {Escherichia coli [TaxId: 469008]}
mkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglre
asdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrnk
aditgetlgmsevnghalirlsartgegvdvlrnhlkqsm

Timeline for d2gj9d_:

• d2gj9d_ first appeared in SCOP 1.73, called d2gj9d1
  
• d2gj9d_ appears in SCOPe 2.02
  
• d2gj9d_ appears in SCOPe 2.04
  
• d2gj9d_ appears in the current release, SCOPe 2.08