Lineage for d2gj9b_ (2gj9 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein automated matches [190047] (37 species)
    not a true protein
  7. Species Escherichia coli [TaxId:469008] [187117] (4 PDB entries)
  8. Domain d2gj9b_: 2gj9 B: [135275]
    automated match to d1rfla_
    complexed with alf, gdp, mg, rb

Details for d2gj9b_

PDB Entry: 2gj9 (more details), 2 Å

PDB Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and Rb+
PDB Compounds: (B:) tRNA modification GTPase trmE

SCOPe Domain Sequences for d2gj9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj9b_ c.37.1.8 (B:) automated matches {Escherichia coli [TaxId: 469008]}
mkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglre
asdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrnk
aditgetlgmsevnghalirlsartgegvdvlrnhlkqsm

SCOPe Domain Coordinates for d2gj9b_ are not available.

Timeline for d2gj9b_:

Domains from other chains:
(mouse over for more information)
d2gj9a_, d2gj9c_, d2gj9d_