Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (34 species) not a true protein |
Species Escherichia coli [TaxId:469008] [187117] (4 PDB entries) |
Domain d2gj8c_: 2gj8 C: [135272] Other proteins in same PDB: d2gj8d3 automated match to d1rfla_ complexed with alf, gdp, k, mg, se |
PDB Entry: 2gj8 (more details), 1.7 Å
SCOPe Domain Sequences for d2gj8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj8c_ c.37.1.8 (C:) automated matches {Escherichia coli [TaxId: 469008]} gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsm
Timeline for d2gj8c_:
View in 3D Domains from other chains: (mouse over for more information) d2gj8a_, d2gj8b_, d2gj8d2, d2gj8d3 |