Lineage for d2gj8c1 (2gj8 C:216-376)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830351Protein Probable tRNA modification GTPase TrmE (MnmE), G domain [102366] (1 species)
  7. 830352Species Escherichia coli [TaxId:562] [102367] (4 PDB entries)
  8. 830355Domain d2gj8c1: 2gj8 C:216-376 [135272]
    automatically matched to d1rfla_
    complexed with alf, gdp, k, mg, se

Details for d2gj8c1

PDB Entry: 2gj8 (more details), 1.7 Å

PDB Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and K+
PDB Compounds: (C:) tRNA modification GTPase trmE

SCOP Domain Sequences for d2gj8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj8c1 c.37.1.8 (C:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}
gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr
easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn
kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsm

SCOP Domain Coordinates for d2gj8c1:

Click to download the PDB-style file with coordinates for d2gj8c1.
(The format of our PDB-style files is described here.)

Timeline for d2gj8c1: