![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Alphaherpesvirus glycoprotein E [141008] (1 species) elaborated with insertions and C-terminal extensions |
![]() | Species Human herpesvirus 1 [TaxId:10298] [141009] (2 PDB entries) Uniprot P04488 218-394! Uniprot P04488 220-390 |
![]() | Domain d2gj7f1: 2gj7 F:220-390 [135269] Other proteins in same PDB: d2gj7a1, d2gj7a2, d2gj7b1, d2gj7b2 automatically matched to 2GJ7 E:220-390 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2gj7 (more details), 5 Å
SCOPe Domain Sequences for d2gj7f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj7f1 b.1.1.1 (F:220-390) Alphaherpesvirus glycoprotein E {Human herpesvirus 1 [TaxId: 10298]} rgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriyes clyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglawqa asvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl
Timeline for d2gj7f1: