Lineage for d2gj6e2 (2gj6 E:118-246)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 935079Protein T-cell antigen receptor [49125] (6 species)
  7. 935105Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 935118Domain d2gj6e2: 2gj6 E:118-246 [135263]
    Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b_, d2gj6d1, d2gj6e1
    automatically matched to d1mi5e2
    complexed with 3ib, gol, so4

Details for d2gj6e2

PDB Entry: 2gj6 (more details), 2.56 Å

PDB Description: the complex between tcr a6 and human class i mhc hla-a2 with the modified htlv-1 tax (y5k-4-[3-indolyl]-butyric acid) peptide
PDB Compounds: (E:) A6-Tcr

SCOPe Domain Sequences for d2gj6e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj6e2 b.1.1.2 (E:118-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d2gj6e2:

Click to download the PDB-style file with coordinates for d2gj6e2.
(The format of our PDB-style files is described here.)

Timeline for d2gj6e2: