Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries) |
Domain d2gj6e2: 2gj6 E:118-246 [135263] Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b1, d2gj6d1, d2gj6e1 automatically matched to d1mi5e2 complexed with 3ib, gol, so4; mutant |
PDB Entry: 2gj6 (more details), 2.56 Å
SCOP Domain Sequences for d2gj6e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj6e2 b.1.1.2 (E:118-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d2gj6e2: