![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries) |
![]() | Domain d2gj6e1: 2gj6 E:3-117 [135262] Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b1, d2gj6d2, d2gj6e2 automatically matched to d1ao7e1 complexed with 3ib, gol, so4; mutant |
PDB Entry: 2gj6 (more details), 2.56 Å
SCOP Domain Sequences for d2gj6e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj6e1 b.1.1.1 (E:3-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvte
Timeline for d2gj6e1: