| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein T-cell antigen receptor [49125] (6 species) |
| Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (7 PDB entries) |
| Domain d2gj6d2: 2gj6 D:118-196 [135261] Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b1, d2gj6d1, d2gj6e1 automatically matched to d1g6ra2 complexed with 3ib, gol, so4; mutant |
PDB Entry: 2gj6 (more details), 2.56 Å
SCOP Domain Sequences for d2gj6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj6d2 b.1.1.2 (D:118-196) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnns
Timeline for d2gj6d2: