![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
![]() | Domain d2gj6d1: 2gj6 D:15-114 [135260] Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b_, d2gj6d2, d2gj6e2 automatically matched to d1g6rb1 complexed with 3ib, gol, so4 |
PDB Entry: 2gj6 (more details), 2.56 Å
SCOPe Domain Sequences for d2gj6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} gaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrftaqlnkasqyvsll irdsqpsdsatylcavttdswgklqfgagtqvvv
Timeline for d2gj6d1: