SCOPe 2.01: Domain d2gj6d1: 2gj6 D:15-114

Lineage for d2gj6d1 (2gj6 D:15-114)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
Domain d2gj6d1: 2gj6 D:15-114 [135260]
Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b_, d2gj6d2, d2gj6e2
automatically matched to d1g6rb1
complexed with 3ib, gol, so4

Details for d2gj6d1

PDB Entry: 2gj6 (more details), 2.56 Å

PDB Description: the complex between tcr a6 and human class i mhc hla-a2 with the modified htlv-1 tax (y5k-4-[3-indolyl]-butyric acid) peptide

PDB Compounds: (D:) A6-Tcr

SCOPe Domain Sequences for d2gj6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
gaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrftaqlnkasqyvsll
irdsqpsdsatylcavttdswgklqfgagtqvvv

SCOPe Domain Coordinates for d2gj6d1:

Click to download the PDB-style file with coordinates for d2gj6d1.
(The format of our PDB-style files is described here.)

Timeline for d2gj6d1: