SCOPe 2.07: Domain d2giyb2: 2giy B:219-390

Lineage for d2giyb2 (2giy B:219-390)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Alphaherpesvirus glycoprotein E [141008] (1 species)
   elaborated with insertions and C-terminal extensions

7. Species Human herpesvirus 1 [TaxId:10298] [141009] (2 PDB entries)
   Uniprot P04488 218-394! Uniprot P04488 220-390

8. Domain d2giyb2: 2giy B:219-390 [135255]
   Other proteins in same PDB: d2giya2, d2giyb3
   automated match to d2giya1

Details for d2giyb2

PDB Entry: 2giy, 1.78 Å

PDB Description: crystal structure of the c-terminal domain of the hsv-1 ge ectodomain

PDB Compounds: (B:) Glycoprotein E

SCOPe Domain Sequences for d2giyb2:

Sequence; same for both SEQRES and ATOM records:

>d2giyb2 b.1.1.1 (B:219-390) Alphaherpesvirus glycoprotein E {Human herpesvirus 1 [TaxId: 10298]}
vrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriye
sclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglawq
aasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl

Timeline for d2giyb2:

• d2giyb2 first appeared in SCOP 1.73, called d2giyb1
  
• d2giyb2 appears in SCOPe 2.06
  
• d2giyb2 appears in the current release, SCOPe 2.08