Lineage for d2giyb2 (2giy B:219-390)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739520Protein Alphaherpesvirus glycoprotein E [141008] (1 species)
    elaborated with insertions and C-terminal extensions
  7. 2739521Species Human herpesvirus 1 [TaxId:10298] [141009] (2 PDB entries)
    Uniprot P04488 218-394! Uniprot P04488 220-390
  8. 2739523Domain d2giyb2: 2giy B:219-390 [135255]
    Other proteins in same PDB: d2giya2, d2giyb3
    automated match to d2giya1
    has additional subdomain(s) that are not in the common domain

Details for d2giyb2

PDB Entry: 2giy (more details), 1.78 Å

PDB Description: crystal structure of the c-terminal domain of the hsv-1 ge ectodomain
PDB Compounds: (B:) Glycoprotein E

SCOPe Domain Sequences for d2giyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2giyb2 b.1.1.1 (B:219-390) Alphaherpesvirus glycoprotein E {Human herpesvirus 1 [TaxId: 10298]}
vrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriye
sclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglawq
aasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl

SCOPe Domain Coordinates for d2giyb2:

Click to download the PDB-style file with coordinates for d2giyb2.
(The format of our PDB-style files is described here.)

Timeline for d2giyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2giyb3